PLN, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-147	50 μL

Catalog No. 89-105-147 Supplier Abnova Corporation Supplier No. H00005350A01

Description

Mouse polyclonal antibody raised against a partial recombinant PLN.

The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. [provided by RefSeq]

Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQN

Specifications

• Antigen: PLN
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PLN.
• Formulation: 50% glycerol
• Gene: PLN
• Gene Accession No.: BC005269
• Gene Alias: CMD1P/PLB
• Gene Symbols: PLN
• Host Species: Mouse
• Immunogen: PLN (AAH05269, 1 a.a. ∽ 30 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5350
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only