PLP1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-148	50 μL

Catalog No. 89-105-148 Supplier Abnova Corporation Supplier No. H00005354A01

Description

Mouse polyclonal antibody raised against a partial recombinant PLP1.

This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene. [provided by RefSeq]

Sequence: YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE

Specifications

• Antigen: PLP1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PLP1.
• Formulation: 50% glycerol
• Gene: PLP1
• Gene Accession No.: NM_000533
• Gene Alias: HLD1/MMPL/PLP/PLP/DM20/PMD/SPG2
• Gene Symbols: PLP1
• Host Species: Mouse
• Immunogen: PLP1 (NP_000524, 177 a.a. ∽ 232 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5354
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only