Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105149

PLP2, Mouse, Clone: 2G7, Abnova™

Catalog No. 89105149 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-149 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-149 Supplier Abnova Corporation Supplier No. H00005355M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant PLP2.

Sequence: MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Specifications

Antigen PLP2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2G7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant PLP2.
Formulation PBS with no preservative; pH 7.4
Gene PLP2
Gene Accession No. NM_002668.1
Gene Alias A4/A4-LSB/MGC126187
Gene Symbols PLP2
Host Species Mouse
Immunogen PLP2 (NP_002659.1,1 a.a. ∽ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5355
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.