Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107220

POLD4, Mouse, Clone: 2B11, Abnova™

Catalog No. 89107220 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-220 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-220 Supplier Abnova Corporation Supplier No. H00057804M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant POLD4.

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM

Sequence: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Specifications

Antigen POLD4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant POLD4.
Formulation ascites with no preservative
Gene POLD4
Gene Accession No. BC001334
Gene Alias POLDS/p12
Gene Symbols POLD4
Host Species Mouse
Immunogen POLD4 (AAH01334,1 a.a. ∽ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57804
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.