Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105167

PON1, Mouse, Clone: 4C7, Abnova™

Catalog No. 89105167 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-167 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-167 Supplier Abnova Corporation Supplier No. H00005444M08
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PON1.

The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3. [provided by RefSeq

Sequence: HVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL

Specifications

Antigen PON1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4C7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PON1.
Formulation PBS with no preservative; pH 7.4
Gene PON1
Gene Accession No. NM_000446
Gene Alias ESA/PON
Gene Symbols PON1
Host Species Mouse
Immunogen PON1 (NP_000437,246 a.a. ∽ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5444
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.