Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105899

PPAP2B, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89105899 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-899 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-899 Supplier Abnova Corporation Supplier No. H00008613A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length recombinant PPAP2B.

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq

Sequence: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKMTLSLPAPAIRKEILSPVDIIDRNNHHNMM

Specifications

Antigen PPAP2B
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length recombinant PPAP2B.
Formulation 50% glycerol
Gene PPAP2B
Gene Accession No. BC009196
Gene Alias Dri42/LPP3/MGC15306/PAP-2b/PAP2-b/PAP2-beta/VCIP
Gene Symbols PPAP2B
Host Species Mouse
Immunogen PPAP2B (AAH09196, 1 a.a. ∽ 311 a.a) full-length recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8613
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.