PPOX, Mouse, Clone: 2B5, Abnova™

Catalog No.	Quantity
89-105-180	200 μL

Catalog No. 89-105-180 Supplier Abnova Corporation Supplier No. H00005498M04A

Description

Mouse monoclonal antibody raised against a partial recombinant PPOX.

This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS

Specifications

• Antigen: PPOX
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PPOX.
• Formulation: ascites with no preservative
• Gene: PPOX
• Gene Accession No.: BC002357
• Gene Alias: MGC8485/PPO/V290M/VP
• Gene Symbols: PPOX
• Host Species: Mouse
• Immunogen: PPOX (AAH02357,378 a.a. ∽ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5498
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ