Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106590

PPP1R13B, Mouse, Clone: 6H1, Abnova™

Catalog No. 89106590 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-590 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-590 Supplier Abnova Corporation Supplier No. H00023368M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PPP1R13B.

This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor. [provided by RefSeq

Sequence: MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWGPRREEVKFFLRHEDSPTENS

Specifications

Antigen PPP1R13B
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6H1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PPP1R13B.
Formulation PBS with no preservative; pH 7.4
Gene PPP1R13B
Gene Accession No. NM_015316.2
Gene Alias ASPP1/KIAA0771/p53BP2-like/p85
Gene Symbols PPP1R13B
Host Species Mouse
Immunogen PPP1R13B (NP_056131.2,1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23368
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.