Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106249

PRG4, Mouse, Clone: 2A6, Abnova™

Catalog No. 89106249 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-249 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-249 Supplier Abnova Corporation Supplier No. H00010216M01A

Description

Mouse monoclonal antibody raised against a partial recombinant PRG4.

The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP

Specifications

Antigen PRG4
Applications ELISA
Classification Monoclonal
Clone 2A6
Conjugate Unconjugated
Description proteoglycan 4
Formulation In ascites fluid
Gene PRG4
Gene Accession No. NM_005807
Gene Alias CACP, FLJ32635, HAPO, JCAP, MSF, SZP, bG174L6.2
Gene Symbols PRG4
Host Species Mouse
Immunogen 1305 a.a. ∽1404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa., PRG4 (NP_005798
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10216
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Ascites
Isotype IgG2a Kappa
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.