PRKACA, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-189	50 μL

Catalog No. 89-105-189 Supplier Abnova Corporation Supplier No. H00005566A01

Description

Mouse polyclonal antibody raised against a partial recombinant PRKACA.

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV

Specifications

• Antigen: PRKACA
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PRKACA.
• Formulation: 50% glycerol
• Gene: PRKACA
• Gene Accession No.: BC039846
• Gene Alias: MGC102831/MGC48865/PKACA
• Gene Symbols: PRKACA
• Host Species: Mouse
• Immunogen: PRKACA (AAH39846, 1 a.a. ∽ 120 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5566
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only