PRKCA, Mouse, Clone: 2F11, Abnova™

Catalog No.	Quantity
89-105-197	200 μL

Catalog No. 89-105-197 Supplier Abnova Corporation Supplier No. H00005578M01A

Description

Mouse monoclonal antibody raised against a partial recombinant PRKCA.

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes. [provided by RefSeq]

Sequence: KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

Specifications

• Antigen: PRKCA
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKCA.
• Formulation: ascites with no preservative
• Gene: PRKCA
• Gene Accession No.: NM_002737
• Gene Alias: AAG6/MGC129900/MGC129901/PKC-alpha/PKCA/PRKACA
• Gene Symbols: PRKCA
• Host Species: Mouse
• Immunogen: PRKCA (NP_002728,563 a.a. ∽ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5578
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ