PRKDC, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-201	50 μL

Catalog No. 89-105-201 Supplier Abnova Corporation Supplier No. H00005591A01

Description

Mouse polyclonal antibody raised against a partial recombinant PRKDC.

The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties.[supplied by OMIM

Sequence: KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM

Specifications

• Antigen: PRKDC
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PRKDC.
• Formulation: 50% glycerol
• Gene: PRKDC
• Gene Accession No.: NM_006904
• Gene Alias: DNA-PKcs/DNAPK/DNPK1/HYRC/HYRC1/XRCC7/p350
• Gene Symbols: PRKDC
• Host Species: Mouse
• Immunogen: PRKDC (NP_008835, 4019 a.a. ∽ 4128 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5591
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only