Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107333

PRKRIP1, Mouse, Clone: M2, Abnova™

Catalog No. 89107333 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-333 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-333 Supplier Abnova Corporation Supplier No. H00079706M08A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant PRKRIP1.

Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR

Specifications

Antigen PRKRIP1
Applications ELISA, Western Blot
Classification Monoclonal
Clone M2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant PRKRIP1.
Formulation ascites with no preservative
Gene PRKRIP1
Gene Accession No. BC014298
Gene Alias C114/FLJ13902/FLJ40957
Gene Symbols PRKRIP1
Host Species Mouse
Immunogen PRKRIP1 (AAH14298,1 a.a. ∽ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79706
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.