PRRX1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-156	50 μL

Catalog No. 89-105-156 Supplier Abnova Corporation Supplier No. H00005396A01

Description

Mouse polyclonal antibody raised against a partial recombinant PRRX1.

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq

Sequence: MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK

Specifications

• Antigen: PRRX1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PRRX1.
• Formulation: 50% glycerol
• Gene: PRRX1
• Gene Accession No.: NM_022716
• Gene Alias: PHOX1/PMX1/PRX1
• Gene Symbols: PRRX1
• Host Species: Mouse
• Immunogen: PRRX1 (NP_073207, 1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5396
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only