PRRX2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-904	50 μL

Catalog No. 89-106-904 Supplier Abnova Corporation Supplier No. H00051450A01

Description

Mouse polyclonal antibody raised against a partial recombinant PRRX2.

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq

Sequence: TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW

Specifications

• Antigen: PRRX2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PRRX2.
• Formulation: 50% glycerol
• Gene: PRRX2
• Gene Accession No.: NM_016307
• Gene Alias: MGC19843/PMX2/PRX2
• Gene Symbols: PRRX2
• Host Species: Mouse
• Immunogen: PRRX2 (NP_057391, 110 a.a. ∽ 202 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51450
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only