PSMD1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-239	50 μL

Catalog No. 89-105-239 Supplier Abnova Corporation Supplier No. H00005707A01

Description

Mouse polyclonal antibody raised against a partial recombinant PSMD1.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes the largest non-ATPase subunit of the 19S regulator lid, which is responsible for substrate recognition and binding. [provided by RefSeq

Sequence: MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTK

Specifications

• Antigen: PSMD1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PSMD1.
• Formulation: 50% glycerol
• Gene: PSMD1
• Gene Accession No.: NM_002807
• Gene Alias: MGC133040/MGC133041/P112/Rpn2/S1
• Gene Symbols: PSMD1
• Host Species: Mouse
• Immunogen: PSMD1 (NP_002798, 1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5707
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only