PTCH, Mouse, Clone: 1B7, Abnova™

Catalog No.	Quantity
89-105-245	200 μL

Catalog No. 89-105-245 Supplier Abnova Corporation Supplier No. H00005727M05A

Description

Mouse monoclonal antibody raised against a partial recombinant PTCH.

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. [provided by RefSeq

Sequence: PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN

Specifications

• Antigen: PTCH
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PTCH.
• Formulation: ascites with no preservative
• Gene: PTCH1
• Gene Accession No.: NM_000264
• Gene Alias: BCNS/FLJ26746/FLJ42602/HPE7/NBCCS/PTC/PTC1/PTCH/PTCH11
• Gene Symbols: PTCH1
• Host Species: Mouse
• Immunogen: PTCH (NP_000255,841 a.a. ∽ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5727
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ