PTGES, Mouse, Clone: 2B9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant PTGES.

Supplier:  Abnova Corporation H00009536M04A

Catalog No. 89-106-100

Description

The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq

Sequence: MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Specifications

• Antigen: PTGES
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC008280
• Gene Symbols: PTGES
• Immunogen: PTGES (AAH08280.1,1 a.a. ∽ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 9536
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA
• Clone: 2B9
• Description: Mouse monoclonal antibody raised against a full-length recombinant PTGES.
• Gene: PTGES
• Gene Alias: MGC10317/MGST-IV/MGST1-L1/MGST1L1/MPGES/PGES/PIG12/PP102/PP1294/TP53I12/mPGES-1
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ