PTK2B (M04A), Mouse anti-Human, Clone: 3G14, Abnova™

Catalog No.	Quantity
89-104-474	200 μL

Catalog No. 89-104-474 Supplier Abnova Corporation Supplier No. H00002185M04A

Description

Mouse monoclonal antibody raised against a partial recombinant PTK2B.

This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA

Specifications

• Antigen: PTK2B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G14
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PTK2B.
• Formulation: ascites with no preservative
• Gene: PTK2B
• Gene Accession No.: BC036651
• Gene Alias: CADTK/CAKB/FADK2/FAK2/FRNK/PKB/PTK/PYK2/RAFTK
• Gene Symbols: PTK2B
• Host Species: Mouse
• Immunogen: PTK2B (AAH36651,682 a.a. ∽ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2185
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ