Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PTK2B (M04), Mouse anti-Human, Clone: 3G14, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PTK2B.

Manufacturer:  Abnova Corporation H00002185M04

Catalog No. 89-104-473


Add to cart

Description

Description

This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA
Specifications

Specifications

PTK2B
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
BC036651
CADTK/CAKB/FADK2/FAK2/FRNK/PKB/PTK/PYK2/RAFTK
Mouse
IgG2a Kappa
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
2185
ELISA, Western Blot
3G14
Mouse monoclonal antibody raised against a partial recombinant PTK2B.
PTK2B
Purified
PTK2B
PTK2B (AAH36651,682 a.a. ∽ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A Purification
RUO
Antibody
Monoclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit