PTPN13, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-255	50 μL

Catalog No. 89-105-255 Supplier Abnova Corporation Supplier No. H00005783A01

Description

Mouse polyclonal antibody raised against a partial recombinant PTPN13.

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP is a large intracellular protein. It has a catalytic PTP domain at its C-terminus and two major structural domains: a region with five PDZ domains and a FERM domain that binds to plasma membrane and cytoskeletal elements. This PTP was found to interact with, and dephosphorylate, Fas receptor and IkappaBalpha through the PDZ domains. This suggests it has a role in Fas mediated programmed cell death. This PTP was also shown to interact with GTPase-activating protein, and thus may function as a regulator of Rho signaling pathways. Four alternatively spliced transcript variants, which encode distinct proteins, have been reported. [provided by RefSeq

Sequence: FTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKL

Specifications

• Antigen: PTPN13
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PTPN13.
• Formulation: 50% glycerol
• Gene: PTPN13
• Gene Accession No.: NM_006264
• Gene Alias: DKFZp686J1497/FAP-1/PNP1/PTP-BAS/PTP-BL/PTP1E/PTPL1/PTPLE
• Gene Symbols: PTPN13
• Host Species: Mouse
• Immunogen: PTPN13 (NP_006255, 66 a.a. ∽ 175 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5783
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only