PTPRM, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-257	50 μL

Catalog No. 89-105-257 Supplier Abnova Corporation Supplier No. H00005797A01

Description

Mouse polyclonal antibody raised against a partial recombinant PTPRM.

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP mu (MAM) domain, an Ig-like domain and four fibronectin type III-like repeats. This PTP has been shown to mediate cell-cell aggregation through the interaction with another molecule of this PTP on an adjacent cell. This PTP can interact with scaffolding protein RACK1/GNB2L1, which may be necessary for the downstream signaling in response to cell-cell adhesion. Alternative splicing results in multiple transcripts encoding distinct isoforms. [provided by RefSeq

Sequence: RGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDE

Specifications

• Antigen: PTPRM
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PTPRM.
• Formulation: 50% glycerol
• Gene: PTPRM
• Gene Accession No.: NM_002845
• Gene Alias: MGC166994/PTPRL1/R-PTP-MU/RPTPM/RPTPU/hR-PTPu
• Gene Symbols: PTPRM
• Host Species: Mouse
• Immunogen: PTPRM (NP_002836, 381 a.a. ∽ 479 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5797
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only