PTTG1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-034	50 μL

Catalog No. 89-106-034 Supplier Abnova Corporation Supplier No. H00009232A01

Description

Mouse polyclonal antibody raised against a partial recombinant PTTG1.

The encoded protein is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The gene product has transforming activity in vitro and tumorigenic activity in vivo, and the gene is highly expressed in various tumors. The gene product contains 2 PXXP motifs, which are required for its transforming and tumorigenic activities, as well as for its stimulation of basic fibroblast growth factor expression. It also contains a destruction box (D box) that is required for its degradation by the APC. The acidic C-terminal region of the encoded protein can act as a transactivation domain. The gene product is mainly a cytosolic protein, although it partially localizes in the nucleus. [provided by RefSeq

Sequence: MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA

Specifications

• Antigen: PTTG1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PTTG1.
• Formulation: 50% glycerol
• Gene: PTTG1
• Gene Accession No.: NM_004219
• Gene Alias: EAP1/HPTTG/MGC126883/MGC138276/PTTG/TUTR1
• Gene Symbols: PTTG1
• Host Species: Mouse
• Immunogen: PTTG1 (NP_004210, 1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9232
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only