Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PURA, Mouse, Clone: 3B7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PURA.

Manufacturer:  Abnova Corporation H00005813M10A

Catalog No. 89-105-262


Add to cart

Description

Description

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia. [provided by RefSeq

Sequence: GAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRR
Specifications

Specifications

PURA
Monoclonal
Unconjugated
ascites with no preservative
NM_005859
PUR-ALPHA/PUR1/PURALPHA
Mouse
IgG2a Kappa
RUO
Antibody
Monoclonal
Human
ELISA
3B7
Mouse monoclonal antibody raised against a partial recombinant PURA.
PURA
Ascites
PURA
PURA (NP_005850.1,92 a.a. ∽ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5813
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit