PURA, Mouse, Clone: 3B7, Abnova™

Catalog No.	Quantity
89-105-262	200 μL

Catalog No. 89-105-262 Supplier Abnova Corporation Supplier No. H00005813M10A

Description

Mouse monoclonal antibody raised against a partial recombinant PURA.

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia. [provided by RefSeq

Sequence: GAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRR

Specifications

• Antigen: PURA
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PURA.
• Formulation: ascites with no preservative
• Gene: PURA
• Gene Accession No.: NM_005859
• Gene Alias: PUR-ALPHA/PUR1/PURALPHA
• Gene Symbols: PURA
• Host Species: Mouse
• Immunogen: PURA (NP_005850.1,92 a.a. ∽ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5813
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ