Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106435

RAB40B, Mouse, Clone: 1A1, Abnova™

Catalog No. 89106435 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-435 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-435 Supplier Abnova Corporation Supplier No. H00010966M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RAB40B.

The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. [provided by RefSeq

Sequence: GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS

Specifications

Antigen RAB40B
Applications ELISA
Classification Monoclonal
Clone 1A1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RAB40B.
Formulation ascites with no preservative
Gene RAB40B
Gene Accession No. BC018039
Gene Alias FLJ42385/RAR/SEC4L
Gene Symbols RAB40B
Host Species Mouse
Immunogen RAB40B (AAH18039,179 a.a. ∽ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10966
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.