Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAD1 (M01C), Mouse anti-Human, Clone: 1G2, Abnova™

Catalog No. 89105261 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-261 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-261 Supplier Abnova Corporation Supplier No. H00005810M01C
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant RAD1.

This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq

Sequence: MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL

Specifications

Antigen RAD1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RAD1.
Formulation tissue culture supernatant with no preservative
Gene RAD1
Gene Accession No. BC006837
Gene Alias HRAD1/REC1
Gene Symbols RAD1
Host Species Mouse
Immunogen RAD1 (AAH06837,1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5810
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.