RARB, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-283	50 μL

Catalog No. 89-105-283 Supplier Abnova Corporation Supplier No. H00005915A01

Description

Mouse polyclonal antibody raised against a partial recombinant RARB.

This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined. [provided by RefSeq

Sequence: MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEG

Specifications

• Antigen: RARB
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RARB.
• Formulation: 50% glycerol
• Gene: RARB
• Gene Accession No.: BC060794
• Gene Alias: HAP/NR1B2/RRB2
• Gene Symbols: RARB
• Host Species: Mouse
• Immunogen: RARB (AAH60794, 1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5915
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only