Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RARRES2 (M27J), Mouse anti-Human, Clone: 4B12, Abnova™

Catalog No. 89105299 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-299 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-299 Supplier Abnova Corporation Supplier No. H00005919M27J
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant RARRES2.

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. [provided by RefSeq

Sequence: VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS

Specifications

Antigen RARRES2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4B12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant RARRES2.
Formulation PBS with no preservative; pH 7.4
Gene RARRES2
Gene Accession No. NM_002889.2
Gene Alias CHEMERIN/HP10433/TIG2
Gene Symbols RARRES2
Host Species Mouse
Immunogen RARRES2 (NP_002880.1,17 a.a. ∽ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5919
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.