RARRES2 (M26J), Mouse anti-Human, Clone: 4C4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant RARRES2.

Supplier:  Abnova Corporation H00005919M26J

Catalog No. 89-105-297

Description

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. [provided by RefSeq

Sequence: VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS

Specifications

• Antigen: RARRES2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002889.2
• Gene Symbols: RARRES2
• Immunogen: RARRES2 (NP_002880.1,17 a.a. ∽ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 4C4
• Description: Mouse monoclonal antibody raised against a full-length recombinant RARRES2.
• Gene: RARRES2
• Gene Alias: CHEMERIN/HP10433/TIG2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5919
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid