Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106395

RBBP9, Mouse, Clone: 2A11, Abnova™

Catalog No. 89106395 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-395 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-395 Supplier Abnova Corporation Supplier No. H00010741M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RBBP9.

The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq

Sequence: THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP

Specifications

Antigen RBBP9
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2A11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RBBP9.
Formulation ascites with no preservative
Gene RBBP9
Gene Accession No. NM_006606
Gene Alias BOG/MGC9236/RBBP10
Gene Symbols RBBP9
Host Species Mouse
Immunogen RBBP9 (NP_006597,87 a.a. ∽ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10741
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.