RCV1, Mouse, Clone: 1D3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RCV1.

Supplier:  Abnova Corporation H00005957M03A

Catalog No. 89-105-311

Description

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq

Sequence: KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN

Specifications

• Antigen: RCV1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_002903.1
• Gene Symbols: RCVRN
• Immunogen: RCV1 (NP_002894.1,101 a.a. ∽ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 5957
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 1D3
• Description: Mouse monoclonal antibody raised against a partial recombinant RCV1.
• Gene: RCVRN
• Gene Alias: RCV1
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ