Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105316

RCV1, Mouse, Clone: 3H1, Abnova™

Catalog No. 89105316 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-316 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-316 Supplier Abnova Corporation Supplier No. H00005957M42A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RCV1.

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq

Sequence: HMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKE

Specifications

Antigen RCV1
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 3H1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RCV1.
Formulation ascites with no preservative
Gene RCVRN
Gene Accession No. BC001720
Gene Alias RCV1
Gene Symbols RCVRN
Host Species Mouse
Immunogen RCV1 (AAH01720.1,91 a.a. ∽ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5957
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.