Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RCV1, Mouse, Clone: 3H1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RCV1.

Manufacturer:  Abnova Corporation H00005957M42A

Catalog No. 89-105-316


Add to cart

Description

Description

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq

Sequence: HMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKE
Specifications

Specifications

RCV1
Monoclonal
Unconjugated
ascites with no preservative
BC001720
RCV1
Mouse
IgG2a Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Immunoprecipitation, Western Blot
3H1
Mouse monoclonal antibody raised against a partial recombinant RCV1.
RCVRN
Ascites
RCVRN
RCV1 (AAH01720.1,91 a.a. ∽ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5957
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit