RCVRN, Mouse, Clone: 4E1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RCVRN.

Supplier:  Abnova Corporation H00005957M15C

Catalog No. 89-105-312

Description

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq

Sequence: NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN

Specifications

• Antigen: RCVRN
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: tissue culture supernatant with no preservative
• Gene Accession No.: NM_002903.1
• Gene Symbols: RCVRN
• Immunogen: RCVRN (NP_002894.1,3 a.a. ∽ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 5957
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4E1
• Description: Mouse monoclonal antibody raised against a partial recombinant RCVRN.
• Gene: RCVRN
• Gene Alias: RCV1
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ