REG3A, Mouse, Clone: 1H4, Abnova™

Catalog No.	Quantity
89-105-047	100 μg

Catalog No. 89-105-047 Supplier Abnova Corporation Supplier No. H00005068M07

Description

Mouse monoclonal antibody raised against a full-length recombinant REG3A.

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Multiple alternatively spliced transcript variants encoding the same protein have been described for this gene but the full length nature of some transcripts is not yet known. [provided by RefSeq

Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Specifications

• Antigen: REG3A
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1H4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant REG3A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: REG3A
• Gene Accession No.: BC036776.1
• Gene Alias: HIP/INGAP/PAP/PAP-H/PAP1/PBCGF/REG-III/REG3
• Gene Symbols: REG3A
• Host Species: Mouse
• Immunogen: REG3A (AAH36776.1,1 a.a. ∽ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5068
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG1 κ