Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105325

RFC3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89105325 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-325 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-325 Supplier Abnova Corporation Supplier No. H00005983A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant RFC3.

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36kDa. This gene encodes the 38kDa subunit. This subunit is essential for the interaction between the 140kDa subunit and the core complex that consists of the 36, 37, and 40kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: ETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Specifications

Antigen RFC3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant RFC3.
Formulation 50% glycerol
Gene RFC3
Gene Accession No. BC000149
Gene Alias MGC5276/RFC38
Gene Symbols RFC3
Host Species Mouse
Immunogen RFC3 (AAH00149, 257 a.a. ∽ 356 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5983
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.