RGS16, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RGS16.

Supplier:  Abnova Corporation H00006004A01

Catalog No. 89-105-332

Description

The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. [provided by RefSeq]

Sequence: ENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRD

Specifications

• Antigen: RGS16
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RGS16.
• Gene: RGS16
• Gene Alias: A28-RGS14/A28-RGS14P/RGS-R
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002928
• Gene Symbols: RGS16
• Immunogen: RGS16 (NP_002919, 90 a.a. ∽ 179 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 6004
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only