RGS17, Mouse, Clone: 2H4, Abnova™

Catalog No.	Quantity
89-106-713	200 μL

Catalog No. 89-106-713 Supplier Abnova Corporation Supplier No. H00026575M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant RGS17.

This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. [provided by RefSeq

Sequence: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Specifications

• Antigen: RGS17
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2H4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant RGS17.
• Formulation: ascites with no preservative
• Gene: RGS17
• Gene Accession No.: BC013117
• Gene Alias: RGS-17/RGSZ2/hRGS17
• Gene Symbols: RGS17
• Host Species: Mouse
• Immunogen: RGS17 (AAH13117,1 a.a. ∽ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26575
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ