RHOC, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-105	50 μL

Catalog No. 89-104-105 Supplier Abnova Corporation Supplier No. H00000389A01

Description

Mouse polyclonal antibody raised against a partial recombinant RHOC.

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: SLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC

Specifications

• Antigen: RHOC
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RHOC.
• Formulation: 50% glycerol
• Gene: RHOC
• Gene Accession No.: NM_175744
• Gene Alias: ARH9/ARHC/H9/MGC1448/MGC61427/RHOH9
• Gene Symbols: RHOC
• Host Species: Mouse
• Immunogen: RHOC (NP_786886, 91 a.a. ∽ 190 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 389
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only