RING1, Mouse, Clone: 2B3, Abnova™

Catalog No.	Quantity
89-105-335	100 μg

Catalog No. 89-105-335 Supplier Abnova Corporation Supplier No. H00006015M03J

Description

Mouse monoclonal antibody raised against a partial recombinant RING1.

This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq

Sequence: NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS

Specifications

• Antigen: RING1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RING1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RING1
• Gene Accession No.: NM_002931
• Gene Alias: RING1A/RNF1
• Gene Symbols: RING1
• Host Species: Mouse
• Immunogen: RING1 (NP_002922,81 a.a. ∽ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6015
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ