Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105930

RIOK3, Mouse, Clone: 3G11, Abnova™

Catalog No. 89105930 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-930 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-930 Supplier Abnova Corporation Supplier No. H00008780M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RIOK3.

This gene was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined. [provided by RefSeq

Sequence: NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE

Specifications

Antigen RIOK3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3G11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RIOK3.
Formulation ascites with no preservative
Gene RIOK3
Gene Accession No. BC039729
Gene Alias DKFZp779L1370/SUDD
Gene Symbols RIOK3
Host Species Mouse
Immunogen RIOK3 (AAH39729,411 a.a. ∽ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8780
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.