RIPK2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RIPK2.

Supplier:  Abnova Corporation H00008767A01

Catalog No. 89-105-927

Description

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq

Sequence: LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Specifications

• Antigen: RIPK2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RIPK2.
• Gene: RIPK2
• Gene Alias: CARD3/CARDIAK/CCK/GIG30/RICK/RIP2
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC004553
• Gene Symbols: RIPK2
• Immunogen: RIPK2 (AAH04553, 431 a.a. ∽ 540 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 8767
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only