RNF24, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RNF24.

Supplier:  Abnova Corporation H00011237A01

Catalog No. 89-106-493

Description

The protein encoded by this gene contains similarity to the Drosophila goliath protein and thus may function as a transcription factor. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq

Sequence: LRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV

Specifications

• Antigen: RNF24
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RNF24.
• Gene: RNF24
• Gene Alias: G1L
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_007219
• Gene Symbols: RNF24
• Immunogen: RNF24 (NP_009150, 49 a.a. ∽ 148 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 11237
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only