ROCK1, Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-105-341	200 μL

Catalog No. 89-105-341 Supplier Abnova Corporation Supplier No. H00006093M01A

Description

Mouse monoclonal antibody raised against a partial recombinant ROCK1.

This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. [provided by RefSeq

Sequence: SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR

Specifications

• Antigen: ROCK1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ROCK1.
• Formulation: ascites with no preservative
• Gene: ROCK1
• Gene Accession No.: NM_005406
• Gene Alias: MGC131603/MGC43611/P160ROCK/PRO0435
• Gene Symbols: ROCK1
• Host Species: Mouse
• Immunogen: ROCK1 (NP_005397,401 a.a. ∽ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6093
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ