RPL15, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-351	50 μL

Catalog No. 89-105-351 Supplier Abnova Corporation Supplier No. H00006138A01

Description

Mouse polyclonal antibody raised against a partial recombinant RPL15.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L15E family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with the yeast ribosomal protein YL10 gene. Although this gene has been referred to as RPL10, its official symbol is RPL15. This gene has been shown to be overexpressed in some esophageal tumors compared to normal matched tissues. Transcript variants utilizing alternative polyA signals exist. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq

Sequence: RAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRY

Specifications

• Antigen: RPL15
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RPL15.
• Formulation: 50% glycerol
• Gene: RPL15
• Gene Accession No.: NM_002948
• Gene Alias: EC45/FLJ26304/MGC88603/RPL10/RPLY10/RPYL10
• Gene Symbols: RPL15
• Host Species: Mouse
• Immunogen: RPL15 (NP_002939, 105 a.a. ∽ 203 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6138
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only