RPL27A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-353	50 μL

Catalog No. 89-105-353 Supplier Abnova Corporation Supplier No. H00006157A01

Description

Mouse polyclonal antibody raised against a partial recombinant RPL27A.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L15P family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, multiple processed pseudogenes derived from this gene are dispersed through the genome. [provided by RefSeq

Sequence: HPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA

Specifications

• Antigen: RPL27A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RPL27A.
• Formulation: 50% glycerol
• Gene: RPL27A
• Gene Accession No.: NM_000990
• Gene Alias: FLJ43464/MGC10850/MGC17878/MGC87238
• Gene Symbols: RPL27A
• Host Species: Mouse
• Immunogen: RPL27A (NP_000981, 49 a.a. ∽ 148 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6157
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only