Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106461

RPP14, Mouse, Clone: 3H4, Abnova™

Catalog No. 89106461 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-461 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-461 Supplier Abnova Corporation Supplier No. H00011102M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RPP14.

Sequence: MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL

Specifications

Antigen RPP14
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3H4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RPP14.
Formulation ascites with no preservative
Gene RPP14
Gene Accession No. NM_007042
Gene Alias FLJ31508/P14
Gene Symbols RPP14
Host Species Mouse
Immunogen RPP14 (NP_008973,1 a.a. ∽ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11102
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.