Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107018

RPRD1A, Mouse, Clone: 1B9, Abnova™

Catalog No. 89107018 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-018 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-018 Supplier Abnova Corporation Supplier No. H00055197M02A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RPRD1A.

P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B; MIM 600431) and may have a role in cell cycle regulation (Liu et al., 2002 [PubMed 12470661]).[supplied by OMIM

Sequence: EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL

Specifications

Antigen RPRD1A
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1B9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RPRD1A.
Formulation ascites with no preservative
Gene RPRD1A
Gene Accession No. NM_018170
Gene Alias FLJ10656/HsT3101/MGC19513/P15RS
Gene Symbols RPRD1A
Host Species Mouse
Immunogen RPRD1A (NP_060640,76 a.a. ∽ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55197
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.