Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RRM2, Mouse, Clone: 1E1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RRM2.

Manufacturer:  Abnova Corporation H00006241M01A

Catalog No. 89-105-376


Add to cart

Description

Description

This gene encodes one of two nonidentical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq

Sequence: MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
Specifications

Specifications

RRM2
Monoclonal
Unconjugated
ascites with no preservative
NM_001034
R2/RR2M
Mouse
IgG1 Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
1E1
Mouse monoclonal antibody raised against a partial recombinant RRM2.
RRM2
Ascites
RRM2
RRM2 (NP_001025,1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6241
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit