Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105380

RXRA (M34J), Mouse anti-Human, Clone: 3F5, Abnova™

Catalog No. 89105380 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-380 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-380 Supplier Abnova Corporation Supplier No. H00006256M34J
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant RXRA.

Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. [provided by RefSeq

Sequence: SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL

Specifications

Antigen RXRA
Applications ELISA
Classification Monoclonal
Clone 3F5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant RXRA.
Formulation PBS with no preservative; pH 7.4
Gene RXRA
Gene Accession No. NM_002957
Gene Alias FLJ00280/FLJ00318/FLJ16020/FLJ16733/MGC102720/NR2B1
Gene Symbols RXRA
Host Species Mouse
Immunogen RXRA (NP_002948.1,27 a.a. ∽ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6256
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.