RXRG, Mouse, Clone: 1B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RXRG.

Supplier:  Abnova Corporation H00006258M02A

Catalog No. 89-105-382

Description

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in nonsmall cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG

Specifications

• Antigen: RXRG
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_001009598
• Gene Symbols: RXRG
• Immunogen: RXRG (-,1 a.a. ∽ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6258
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA
• Clone: 1B2
• Description: Mouse monoclonal antibody raised against a partial recombinant RXRG.
• Gene: RXRG
• Gene Alias: NR2B3/RXRC
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ