RXRG, Mouse, Clone: 1B2, Abnova™

Catalog No.	Quantity
89-105-382	200 μL

Catalog No. 89-105-382 Supplier Abnova Corporation Supplier No. H00006258M02A

Description

Mouse monoclonal antibody raised against a partial recombinant RXRG.

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in nonsmall cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG

Specifications

• Antigen: RXRG
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RXRG.
• Formulation: ascites with no preservative
• Gene: RXRG
• Gene Accession No.: NM_001009598
• Gene Alias: NR2B3/RXRC
• Gene Symbols: RXRG
• Host Species: Mouse
• Immunogen: RXRG (-,1 a.a. ∽ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6258
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ